PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 273aa    MW: 31266.2 Da    PI: 9.5954
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627118.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-192067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+d+v+++G g+W+++ar  g++R +k+c++rw +yl
   XP_013627118.1 20 KGPWTAEEDRLLIDYVRLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 67
                     79********************************************97 PP

2Myb_DNA-binding49.31.1e-1573117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
   XP_013627118.1  73 RGQITPYEEIIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                      6788999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8061571IPR017930Myb domain
SuperFamilySSF466892.93E-3017114IPR009057Homeodomain-like
SMARTSM007177.2E-171969IPR001005SANT/Myb domain
PfamPF002491.0E-172067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-232174IPR009057Homeodomain-like
CDDcd001671.78E-122267No hitNo description
PROSITE profilePS5129419.26672122IPR017930Myb domain
SMARTSM007171.9E-1372120IPR001005SANT/Myb domain
PfamPF002491.5E-1373117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2475121IPR009057Homeodomain-like
CDDcd001671.26E-977118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MSLWGVMGGG WGLVEEGWRK GPWTAEEDRL LIDYVRLHGE GRWNSVARLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPYE EIIILELHAK WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KTKSPSNNAE KTKNRILKRQ QFQQQRRMEL QQEQQLLQFN QIDVNKIMSL LDDNNNYNDF  180
SSSSSGSSGE GGAFYVPHQI KIPTPNSGHD PNGNGFCPVV PAPTVEANVN EDFAIWNGIW  240
NLDLEGQGSF GDGACVPRKH CFQNWPIPSN LTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-252012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894910.0AC189491.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084M06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627118.10.0PREDICTED: myb-related protein 305-like
RefseqXP_013710503.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0D3BD120.0A0A0D3BD12_BRAOL; Uncharacterized protein
STRINGBra001941.1-P1e-158(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-120myb domain protein 305